SCOPe 2.08: Domain d3ek6a1: 3ek6 A:1-240

Lineage for d3ek6a1 (3ek6 A:1-240)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.0: automated matches [191466] (1 protein)
   not a true family

6. Protein automated matches [190728] (15 species)
   not a true protein

7. Species Xanthomonas campestris pv. campestris [TaxId:340] [188705] (2 PDB entries)

8. Domain d3ek6a1: 3ek6 A:1-240 [175002]
   Other proteins in same PDB: d3ek6a2
   automated match to d2bnda1

Details for d3ek6a1

PDB Entry: 3ek6, 2.34 Å

PDB Description: Unique GTP-binding Pocket and Allostery of UMP Kinase from a Gram-Negative Phytopathogen Bacterium

PDB Compounds: (A:) uridylate kinase

SCOPe Domain Sequences for d3ek6a1:

Sequence; same for both SEQRES and ATOM records:

>d3ek6a1 c.73.1.0 (A:1-240) automated matches {Xanthomonas campestris pv. campestris [TaxId: 340]}
mselsyrrillklsgealmgdgdygidpkvinrlahevieaqqagaqvalvigggnifrg
aglaasgmdrvtgdhmgmlatvinalamqdaleklgakvrvmsaikindvcedfirrrai
rhlekgriaifaagtgnpffttdsgaalraieigadlllkatkvdgvydkdpkkhsdavr
ydsltydevimqglevmdtaafalardsdlplrifgmsepgvllrilhgaqigtlvqgrs

Timeline for d3ek6a1:

• d3ek6a1 first appeared in SCOPe 2.01, called d3ek6a_
  
• d3ek6a1 appears in SCOPe 2.07