Lineage for d2bnda1 (2bnd A:5-241)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the restSuperfamily c.73.1: Carbamate kinase-like [53633] (4 families) 
the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
Family c.73.1.3: PyrH-like [142721] (4 proteins)
part of Pfam PF00696Protein Uridylate kinase PyrH [142728] (6 species) 
Species Escherichia coli [TaxId:562] [142730] (1 PDB entry)
Uniprot P0A7E9 4-240
Domain d2bnda1: 2bnd A:5-241 [128822]
Other proteins in same PDB: d2bndb_
complexed with gol, pop, udp
Details for d2bnda1
PDB Entry: 2bnd (more details), 2.6 Å
PDB Description: the structure of e.coli ump kinase in complex with udp
PDB Compounds: (A:) uridylate kinaseSCOPe Domain Sequences for d2bnda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bnda1 c.73.1.3 (A:5-241) Uridylate kinase PyrH {Escherichia coli [TaxId: 562]}
akpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnlfrga
glakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplnavcdsyswaeais
llrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdptatmy
eqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite
SCOPe Domain Coordinates for d2bnda1:
Click to download the PDB-style file with coordinates for d2bnda1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bnda1:
- d2bnda1 first appeared in SCOP 1.73
- d2bnda1 appears in SCOPe 2.07
View in 3D
