SCOPe 2.08: Domain d2bndb_: 2bnd B:

Lineage for d2bndb_ (2bnd B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.3: PyrH-like [142721] (4 proteins)
   part of Pfam PF00696

6. Protein automated matches [190400] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187476] (1 PDB entry)

8. Domain d2bndb_: 2bnd B: [128823]
   Other proteins in same PDB: d2bnda1
   automated match to d2bnda1
   complexed with gol, pop, udp

Details for d2bndb_

PDB Entry: 2bnd, 2.6 Å

PDB Description: the structure of e.coli ump kinase in complex with udp

PDB Compounds: (B:) uridylate kinase

SCOPe Domain Sequences for d2bndb_:

Sequence, based on SEQRES records:

>d2bndb_ c.73.1.3 (B:) automated matches {Escherichia coli [TaxId: 562]}
nakpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnlfrg
aglakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplnavcdsyswaeai
sllrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdptatm
yeqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite

Sequence, based on observed residues (ATOM records):

>d2bndb_ c.73.1.3 (B:) automated matches {Escherichia coli [TaxId: 562]}
nakpvykrillklsgealqgtefgidasildrmaqeikelvelgiqvgvvigggnlfrga
glakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplnavcdsyswaeais
llrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdptatmy
eqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite

Timeline for d2bndb_:

• d2bndb_ first appeared in SCOP 1.73, called d2bndb1
  
• d2bndb_ appears in SCOPe 2.07