Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.27: CalX-like [141072] (2 families) |
Family b.1.27.0: automated matches [191575] (1 protein) not a true family |
Protein automated matches [191010] (2 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [188762] (3 PDB entries) |
Domain d3eadd_: 3ead D: [174802] automated match to d2fwsa1 complexed with ca, gol |
PDB Entry: 3ead (more details), 2.25 Å
SCOPe Domain Sequences for d3eadd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eadd_ b.1.27.0 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} irmyfepghytvmencgefevrvvrrgdistyasveyetqdgtasagtdfvgrkgllsfp pgvdeqrfrievidddvfeedecfyirlfnpsegvklavpmiatvmilddd
Timeline for d3eadd_: