SCOPe 2.07: Domain d3eadb_: 3ead B:

Lineage for d3eadb_ (3ead B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.27: CalX-like [141072] (2 families)

5. Family b.1.27.0: automated matches [191575] (1 protein)
   not a true family

6. Protein automated matches [191010] (2 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [188762] (3 PDB entries)

8. Domain d3eadb_: 3ead B: [174800]
   automated match to d2fwsa1
   complexed with ca, gol

Details for d3eadb_

PDB Entry: 3ead, 2.25 Å

PDB Description: crystal structure of calx-cbd1

PDB Compounds: (B:) Na/Ca exchange protein

SCOPe Domain Sequences for d3eadb_:

Sequence; same for both SEQRES and ATOM records:

>d3eadb_ b.1.27.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pirmyfepghytvmencgefevrvvrrgdistyasveyetqdgtasagtdfvgrkgllsf
ppgvdeqrfrievidddvfeedecfyirlfnpsegvklavpmiatvmildddha

Timeline for d3eadb_:

• d3eadb_ first appeared in SCOPe 2.01
  
• d3eadb_ appears in SCOPe 2.06
  
• d3eadb_ appears in the current release, SCOPe 2.08