Lineage for d3eadd_ (3ead D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766760Superfamily b.1.27: CalX-like [141072] (2 families) (S)
  5. 2766776Family b.1.27.0: automated matches [191575] (1 protein)
    not a true family
  6. 2766777Protein automated matches [191010] (2 species)
    not a true protein
  7. 2766778Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [188762] (3 PDB entries)
  8. 2766786Domain d3eadd_: 3ead D: [174802]
    automated match to d2fwsa1
    complexed with ca, gol

Details for d3eadd_

PDB Entry: 3ead (more details), 2.25 Å

PDB Description: crystal structure of calx-cbd1
PDB Compounds: (D:) Na/Ca exchange protein

SCOPe Domain Sequences for d3eadd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eadd_ b.1.27.0 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
irmyfepghytvmencgefevrvvrrgdistyasveyetqdgtasagtdfvgrkgllsfp
pgvdeqrfrievidddvfeedecfyirlfnpsegvklavpmiatvmilddd

SCOPe Domain Coordinates for d3eadd_:

Click to download the PDB-style file with coordinates for d3eadd_.
(The format of our PDB-style files is described here.)

Timeline for d3eadd_: