Lineage for d1mjma_ (1mjm A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.43: Met repressor-like [47597] (1 superfamily) Superfamily a.43.1: Met repressor-like [47598] (2 families) 
Family a.43.1.2: Bacterial repressors [47604] (2 proteins) 
Protein Met repressor, MetR [47607] (1 species) Species Escherichia coli [TaxId:562] [47608] (10 PDB entries) 
Domain d1mjma_: 1mjm A: [17472]
Details for d1mjma_
PDB Entry: 1mjm (more details), 2.2 Å
PDB Description: methionine aporepressor mutant (q44k) complexed to half of the consensus operator sequence
SCOP Domain Sequences for d1mjma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mjma_ a.43.1.2 (A:) Met repressor, MetR {Escherichia coli}
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey
SCOP Domain Coordinates for d1mjma_:
Click to download the PDB-style file with coordinates for d1mjma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mjma_:
- d1mjma_ appears in SCOP 1.57
- d1mjma_ appears in the current release, SCOPe 2.08
View in 3D
