SCOPe 2.08: Domain d1mjlb_: 1mjl B:

Lineage for d1mjlb_ (1mjl B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.5: Met repressor, MetJ (MetR) [100972] (1 protein)
   automatically mapped to Pfam PF01340

6. Protein Met repressor, MetJ (MetR) [47607] (1 species)

7. Species Escherichia coli [TaxId:562] [47608] (10 PDB entries)

8. Domain d1mjlb_: 1mjl B: [17471]
   complexed with sam; mutant

Details for d1mjlb_

PDB Entry: 1mjl, 2.1 Å

PDB Description: methionine repressor mutant (q44k) complex with the corepressor sam (s-adenosyl methionine) from escherichia coli

PDB Compounds: (B:) methionine repressor protein metj

SCOPe Domain Sequences for d1mjlb_:

Sequence; same for both SEQRES and ATOM records:

>d1mjlb_ a.43.1.5 (B:) Met repressor, MetJ (MetR) {Escherichia coli [TaxId: 562]}
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

Timeline for d1mjlb_:

• d1mjlb_ first appeared (with stable ids) in SCOP 1.55
  
• d1mjlb_ appears in SCOPe 2.07