PDB entry 1mjl

View 1mjl on RCSB PDB site
Description: methionine repressor mutant (q44k) complex with the corepressor sam (s-adenosyl methionine) from escherichia coli
Class: transcription regulation
Keywords: metj, repressor, sheet-helix-helix, sam, s-adenosyl methionine, transcription regulation
Deposited on 1998-01-26, released 1998-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.193
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methionine repressor protein metj
    Species: Escherichia coli [TaxId:562]
    Gene: METJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8U6 (0-103)
      • engineered (43)
    Domains in SCOPe 2.08: d1mjla_
  • Chain 'B':
    Compound: methionine repressor protein metj
    Species: Escherichia coli [TaxId:562]
    Gene: METJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8U6 (0-103)
      • engineered (43)
    Domains in SCOPe 2.08: d1mjlb_
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mjlA (A:)
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mjlB (B:)
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey