Lineage for d1mjla_ (1mjl A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712590Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 2712591Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 2712706Family a.43.1.5: Met repressor, MetJ (MetR) [100972] (1 protein)
    automatically mapped to Pfam PF01340
  6. 2712707Protein Met repressor, MetJ (MetR) [47607] (1 species)
  7. 2712708Species Escherichia coli [TaxId:562] [47608] (10 PDB entries)
  8. 2712711Domain d1mjla_: 1mjl A: [17470]
    complexed with sam; mutant

Details for d1mjla_

PDB Entry: 1mjl (more details), 2.1 Å

PDB Description: methionine repressor mutant (q44k) complex with the corepressor sam (s-adenosyl methionine) from escherichia coli
PDB Compounds: (A:) methionine repressor protein metj

SCOPe Domain Sequences for d1mjla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjla_ a.43.1.5 (A:) Met repressor, MetJ (MetR) {Escherichia coli [TaxId: 562]}
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

SCOPe Domain Coordinates for d1mjla_:

Click to download the PDB-style file with coordinates for d1mjla_.
(The format of our PDB-style files is described here.)

Timeline for d1mjla_: