Lineage for d3dxkc_ (3dxk C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2075644Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2075799Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2075800Family b.69.4.1: WD40-repeat [50979] (13 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 2075913Protein automated matches [190346] (4 species)
    not a true protein
  7. 2075914Species Cow (Bos taurus) [TaxId:9913] [187173] (14 PDB entries)
  8. 2075922Domain d3dxkc_: 3dxk C: [174327]
    Other proteins in same PDB: d3dxka1, d3dxka2, d3dxkb_, d3dxkd1, d3dxkd2, d3dxke_, d3dxkf_, d3dxkg_
    automated match to d1tyqc_
    complexed with n23

Details for d3dxkc_

PDB Entry: 3dxk (more details), 2.7 Å

PDB Description: Structure of Bos Taurus Arp2/3 Complex with Bound Inhibitor CK0944636
PDB Compounds: (C:) Actin-related protein 2/3 complex subunit 1B

SCOPe Domain Sequences for d3dxkc_:

Sequence, based on SEQRES records: (download)

>d3dxkc_ b.69.4.1 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgidwa
pdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvis
icyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerpa
ptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatla
setlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpkqssqrgltarer
fqnldkkassegsaaagagldslhknsvsqisvlsggkakcsqfcttgmdggmsiwdvrs
lesalkdlkiv

Sequence, based on observed residues (ATOM records): (download)

>d3dxkc_ b.69.4.1 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgidwa
pdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvis
icyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerpa
ptpwgskmpfgelmfesscgwvhgvcfsangsrvawvshdstvcladadkkmavatlase
tlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpagldslhknsvsqis
vlsggkakcsqfcttgmdggmsiwdvrslesalkdlkiv

SCOPe Domain Coordinates for d3dxkc_:

Click to download the PDB-style file with coordinates for d3dxkc_.
(The format of our PDB-style files is described here.)

Timeline for d3dxkc_: