Lineage for d1tyqc_ (1tyq C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2075644Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2075799Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2075800Family b.69.4.1: WD40-repeat [50979] (13 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 2075818Protein Arp2/3 complex 41 kDa subunit ARPC1 [69313] (1 species)
  7. 2075819Species Cow (Bos taurus) [TaxId:9913] [69314] (3 PDB entries)
    Uniprot Q58CQ2
  8. 2075822Domain d1tyqc_: 1tyq C: [112844]
    Other proteins in same PDB: d1tyqa1, d1tyqa2, d1tyqb1, d1tyqd1, d1tyqd2, d1tyqe_, d1tyqf_, d1tyqg_
    complexed with atp, ca

Details for d1tyqc_

PDB Entry: 1tyq (more details), 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ATP and calcium
PDB Compounds: (C:) Arp2/3 complex 41kDa subunit

SCOPe Domain Sequences for d1tyqc_:

Sequence, based on SEQRES records: (download)

>d1tyqc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}
mayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgvdw
apdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvi
sicyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerp
aptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatl
asetlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpkqssqrgltare
rfqnldkkassegsaaagagldslhknsvsqisvlsggkakcsqfcttgmdggmsiwdvr
slesalkdlkiv

Sequence, based on observed residues (ATOM records): (download)

>d1tyqc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}
mayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgvdw
apdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvi
sicyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerp
aptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatl
asetlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpagldslhknsvs
qisvlsggkakcsqfcttgmdggmsiwdvrslesalkdlkiv

SCOPe Domain Coordinates for d1tyqc_:

Click to download the PDB-style file with coordinates for d1tyqc_.
(The format of our PDB-style files is described here.)

Timeline for d1tyqc_: