Lineage for d3dxea_ (3dxe A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803713Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2803714Protein automated matches [190052] (8 species)
    not a true protein
  7. 2803789Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)
  8. 2803871Domain d3dxea_: 3dxe A: [174321]
    automated match to d1wgua_
    mutant

Details for d3dxea_

PDB Entry: 3dxe (more details), 2 Å

PDB Description: crystal structure of the intracellular domain of human app (t668a mutant) in complex with fe65-ptb2
PDB Compounds: (A:) Amyloid beta A4 protein-binding family B member 1

SCOPe Domain Sequences for d3dxea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dxea_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fqvyylgnvpvakpvgvdvingalesvlssssreqwtpshvsvapatltilhqqteavlg
ecrvrflsflavgrdvhtfafimaagpasfcchmfwcepnaaslseavqaacmlryqkcl
dars

SCOPe Domain Coordinates for d3dxea_:

Click to download the PDB-style file with coordinates for d3dxea_.
(The format of our PDB-style files is described here.)

Timeline for d3dxea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3dxec_