SCOPe 2.08: Domain d3dxea_: 3dxe A:

Lineage for d3dxea_ (3dxe A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)

8. Domain d3dxea_: 3dxe A: [174321]
   automated match to d1wgua_
   mutant

Details for d3dxea_

PDB Entry: 3dxe, 2 Å

PDB Description: crystal structure of the intracellular domain of human app (t668a mutant) in complex with fe65-ptb2

PDB Compounds: (A:) Amyloid beta A4 protein-binding family B member 1

SCOPe Domain Sequences for d3dxea_:

Sequence; same for both SEQRES and ATOM records:

>d3dxea_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fqvyylgnvpvakpvgvdvingalesvlssssreqwtpshvsvapatltilhqqteavlg
ecrvrflsflavgrdvhtfafimaagpasfcchmfwcepnaaslseavqaacmlryqkcl
dars

Timeline for d3dxea_:

• d3dxea_ first appeared in SCOPe 2.01
  
• d3dxea_ appears in SCOPe 2.07