PDB entry 3dxe

View 3dxe on RCSB PDB site
Description: Crystal structure of the intracellular domain of human APP (T668A mutant) in complex with Fe65-PTB2
Class: protein binding
Keywords: Alzheimer's disease, APP, AICD, Fe65, PTB domain, Alzheimer disease, Amyloid, Apoptosis, Cell adhesion, Coated pit, Disease mutation, Endocytosis, Glycoprotein, Heparin-binding, Iron, Membrane, Metal-binding, Notch signaling pathway, Phosphoprotein, Protease inhibitor, Proteoglycan, Serine protease inhibitor, Transmembrane, PROTEIN BINDING
Deposited on 2008-07-24, released 2008-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amyloid beta A4 protein-binding family B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: APBB1, FE65, RIR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3dxea_
  • Chain 'B':
    Compound: amyloid beta a4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: APP, A4, AD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05067
      • engineered (7)
  • Chain 'C':
    Compound: Amyloid beta A4 protein-binding family B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: APBB1, FE65, RIR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3dxec_
  • Chain 'D':
    Compound: amyloid beta a4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: APP, A4, AD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05067
      • engineered (7)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dxeA (A:)
    apknelvqkfqvyylgnvpvakpvgvdvingalesvlssssreqwtpshvsvapatltil
    hqqteavlgecrvrflsflavgrdvhtfafimaagpasfcchmfwcepnaaslseavqaa
    cmlryqkcldarsqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dxeA (A:)
    fqvyylgnvpvakpvgvdvingalesvlssssreqwtpshvsvapatltilhqqteavlg
    ecrvrflsflavgrdvhtfafimaagpasfcchmfwcepnaaslseavqaacmlryqkcl
    dars
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dxeC (C:)
    apknelvqkfqvyylgnvpvakpvgvdvingalesvlssssreqwtpshvsvapatltil
    hqqteavlgecrvrflsflavgrdvhtfafimaagpasfcchmfwcepnaaslseavqaa
    cmlryqkcldarsqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dxeC (C:)
    nelvqkfqvyylgnvpvakpvgvdvingalesvlssssreqwtpshvsvapatltilhqq
    teavlgecrvrflsflavgrdvhtfafimaagpasfcchmfwcepnaaslseavqaacml
    ryqkcldars
    

  • Chain 'D':
    No sequence available.