Lineage for d1wgua_ (1wgu A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798838Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1798839Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1799111Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 1799112Protein Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 [117259] (1 species)
  7. 1799113Species Mouse (Mus musculus) [TaxId:10090] [117260] (2 PDB entries)
    Uniprot Q9DBR4 582-704
  8. 1799114Domain d1wgua_: 1wgu A: [114623]
    Structural genomics target

Details for d1wgua_

PDB Entry: 1wgu (more details)

PDB Description: solution structure of the c-terminal phosphotyrosine interaction domain of apbb2 from mouse
PDB Compounds: (A:) amyloid beta (A4) precursor protein-bindin, family B, member 2

SCOPe Domain Sequences for d1wgua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgua_ b.55.1.2 (A:) Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgptpktelvqkfrvqylgmlpvdrpvgmdtlnsaienlmtssskedwpsvnmnv
adatvtvisekneeevlvecrvrflsfmgvgkdvhtfafimdtgnqrfechvfwcepnaa
nvseavqaacsgpssg

SCOPe Domain Coordinates for d1wgua_:

Click to download the PDB-style file with coordinates for d1wgua_.
(The format of our PDB-style files is described here.)

Timeline for d1wgua_: