SCOPe 2.08: Domain d1wgua1: 1wgu A:8-130

Lineage for d1wgua1 (1wgu A:8-130)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
   Pfam PF00640

6. Protein Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 [117259] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117260] (2 PDB entries)
   Uniprot Q9DBR4 582-704

8. Domain d1wgua1: 1wgu A:8-130 [114623]
   Other proteins in same PDB: d1wgua2, d1wgua3
   Structural genomics target
   has additional insertions and/or extensions that are not grouped together

Details for d1wgua1

PDB Entry: 1wgu

PDB Description: solution structure of the c-terminal phosphotyrosine interaction domain of apbb2 from mouse

PDB Compounds: (A:) amyloid beta (A4) precursor protein-bindin, family B, member 2

SCOPe Domain Sequences for d1wgua1:

Sequence; same for both SEQRES and ATOM records:

>d1wgua1 b.55.1.2 (A:8-130) Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 {Mouse (Mus musculus) [TaxId: 10090]}
ptpktelvqkfrvqylgmlpvdrpvgmdtlnsaienlmtssskedwpsvnmnvadatvtv
isekneeevlvecrvrflsfmgvgkdvhtfafimdtgnqrfechvfwcepnaanvseavq
aac

Timeline for d1wgua1:

• d1wgua1 first appeared in SCOP 1.71, called d1wgua_
  
• d1wgua1 appears in SCOPe 2.07