Lineage for d3dqka1 (3dqk A:2-230)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2939778Protein Green fluorescent protein, GFP [54513] (6 species)
  7. 2939786Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
    Uniprot P42212
  8. 2939847Domain d3dqka1: 3dqk A:2-230 [174180]
    Other proteins in same PDB: d3dqka2
    automated match to d1huya_

Details for d3dqka1

PDB Entry: 3dqk (more details), 1.4 Å

PDB Description: structure of the yellow fluorescent protein citrine frozen at 1000 atmospheres number 2: structure 6 in a series of 26 high pressure structures
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d3dqka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dqka1 d.22.1.1 (A:2-230) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttfgyglmcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagit

SCOPe Domain Coordinates for d3dqka1:

Click to download the PDB-style file with coordinates for d3dqka1.
(The format of our PDB-style files is described here.)

Timeline for d3dqka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dqka2