Lineage for d3dhre_ (3dhr E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688626Species Domestic pigeon (Columba livia) [TaxId:8932] [188616] (2 PDB entries)
  8. 2688635Domain d3dhre_: 3dhr E: [173963]
    automated match to d1fawa_
    complexed with hem

Details for d3dhre_

PDB Entry: 3dhr (more details), 2 Å

PDB Description: crystal structure determination of methemoglobin from pigeon at 2 angstrom resolution (columba livia)
PDB Compounds: (E:) Hemoglobin subunit alpha-A

SCOPe Domain Sequences for d3dhre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dhre_ a.1.1.2 (E:) automated matches {Domestic pigeon (Columba livia) [TaxId: 8932]}
vlsandksnvkavfakiggqagdlggealerlfitypqtktyfphfdlshgsaqikghgk
kvaealveaanhiddiagalsklsdlhaqklrvdpvnfkllghcflvvvavhfpslltpe
vhasldkfvlavgtvltakyr

SCOPe Domain Coordinates for d3dhre_:

Click to download the PDB-style file with coordinates for d3dhre_.
(The format of our PDB-style files is described here.)

Timeline for d3dhre_: