Lineage for d3dhrf_ (3dhr F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688626Species Domestic pigeon (Columba livia) [TaxId:8932] [188616] (2 PDB entries)
  8. 2688636Domain d3dhrf_: 3dhr F: [173964]
    automated match to d1fawb_
    complexed with hem

Details for d3dhrf_

PDB Entry: 3dhr (more details), 2 Å

PDB Description: crystal structure determination of methemoglobin from pigeon at 2 angstrom resolution (columba livia)
PDB Compounds: (F:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3dhrf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dhrf_ a.1.1.2 (F:) automated matches {Domestic pigeon (Columba livia) [TaxId: 8932]}
hwsaeekqlitsiwgkvnvadcgaealarllivypwtqrffssfgnlssataisgnpnvk
ahgkkvltsfgdavknldnikgtfaqlselhcdklhvdpenfrllgdilviilaahfgkd
ftpecqaawqklvrvvahalarkyh

SCOPe Domain Coordinates for d3dhrf_:

Click to download the PDB-style file with coordinates for d3dhrf_.
(The format of our PDB-style files is described here.)

Timeline for d3dhrf_: