Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [118213] (5 PDB entries) Uniprot P97287 152-308 |
Domain d3d7va_: 3d7v A: [173748] automated match to d1wsxa_ complexed with zn |
PDB Entry: 3d7v (more details), 2.03 Å
SCOPe Domain Sequences for d3d7va_:
Sequence, based on SEQRES records: (download)
>d3d7va_ f.1.4.1 (A:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Mouse (Mus musculus) [TaxId: 10090]} ddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqgm lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla esitdvlvrtkrdwlvkqrgwdgfveffhve
>d3d7va_ f.1.4.1 (A:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Mouse (Mus musculus) [TaxId: 10090]} ddlyrqsleiisrylreqatgskdgaagrraletlrrvgdgvqrnhetafqgmlrkldik neddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqescieplaesitdvl vrtkrdwlvkqrgwdgfveffhve
Timeline for d3d7va_: