SCOPe 2.08: Domain d3d7va_: 3d7v A:

Lineage for d3d7va_ (3d7v A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [188549] (62 PDB entries)

8. Domain d3d7va_: 3d7v A: [173748]
   automated match to d1wsxa_
   complexed with zn

Details for d3d7va_

PDB Entry: 3d7v, 2.03 Å

PDB Description: crystal structure of mcl-1 in complex with an mcl-1 selective bh3 ligand

PDB Compounds: (A:) Induced myeloid leukemia cell differentiation protein Mcl-1

SCOPe Domain Sequences for d3d7va_:

Sequence, based on SEQRES records:

>d3d7va_ f.1.4.1 (A:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Human (Homo sapiens) [TaxId: 9606]}
ddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqgm
lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla
esitdvlvrtkrdwlvkqrgwdgfveffhve

Sequence, based on observed residues (ATOM records):

>d3d7va_ f.1.4.1 (A:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Human (Homo sapiens) [TaxId: 9606]}
ddlyrqsleiisrylreqatgskdgaagrraletlrrvgdgvqrnhetafqgmlrkldik
neddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqescieplaesitdvl
vrtkrdwlvkqrgwdgfveffhve

Timeline for d3d7va_:

• d3d7va_ first appeared in SCOPe 2.01
  
• d3d7va_ appears in SCOPe 2.07