Lineage for d3d5oa_ (3d5o A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779650Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
    automatically mapped to Pfam PF00354
  6. 2779738Protein Serum amyloid P component (SAP) [49952] (1 species)
  7. 2779739Species Human (Homo sapiens) [TaxId:9606] [49953] (12 PDB entries)
  8. 2779805Domain d3d5oa_: 3d5o A: [173701]
    Other proteins in same PDB: d3d5of1, d3d5of2
    automated match to d1gyka_
    complexed with gol, nag, so4

Details for d3d5oa_

PDB Entry: 3d5o (more details), 2.8 Å

PDB Description: structural recognition and functional activation of fcrr by innate pentraxins
PDB Compounds: (A:) serum amyloid p-component

SCOPe Domain Sequences for d3d5oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5oa_ b.29.1.5 (A:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

SCOPe Domain Coordinates for d3d5oa_:

Click to download the PDB-style file with coordinates for d3d5oa_.
(The format of our PDB-style files is described here.)

Timeline for d3d5oa_: