SCOPe 2.08: Domain d3d5of1: 3d5o F:1-85

Lineage for d3d5of1 (3d5o F:1-85)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries)

8. Domain d3d5of1: 3d5o F:1-85 [199224]
   Other proteins in same PDB: d3d5oa_, d3d5ob_, d3d5oc_, d3d5od_, d3d5oe_
   automated match to d2fcba1
   complexed with gol, nag, so4

Details for d3d5of1

PDB Entry: 3d5o, 2.8 Å

PDB Description: structural recognition and functional activation of fcrr by innate pentraxins

PDB Compounds: (F:) Low affinity immunoglobulin gamma Fc region receptor II-a

SCOPe Domain Sequences for d3d5of1:

Sequence; same for both SEQRES and ATOM records:

>d3d5of1 b.1.1.4 (F:1-85) automated matches {Human (Homo sapiens) [TaxId: 9606]}
appkavlkleppwinvlqedsvtltcqgarspesdsiqwfhngnlipthtqpsyrfkann
ndsgeytcqtgqtslsdpvhltvls

Timeline for d3d5of1:

• d3d5of1 first appeared in SCOPe 2.03
  
• d3d5of1 appears in SCOPe 2.07