PDB entry 3d5o

View 3d5o on RCSB PDB site
Description: Structural recognition and functional activation of FcrR by innate pentraxins
Class: immune system
Keywords: complex structure, SAP, Fc RIIa, Fc receptor activation, pentraxins, Amyloid, Glycoprotein, Lectin, Metal-binding, Secreted, Cell membrane, IgG-binding protein, Immunoglobulin domain, Membrane, Phosphoprotein, Receptor, Transmembrane, IMMUNE SYSTEM
Deposited on 2008-05-16, released 2008-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.207
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d5oa_
  • Chain 'B':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d5ob_
  • Chain 'C':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d5oc_
  • Chain 'D':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d5od_
  • Chain 'E':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d5oe_
  • Chain 'F':
    Compound: Low affinity immunoglobulin gamma Fc region receptor II-a
    Species: Homo sapiens [TaxId:9606]
    Gene: FCGR2A, CD32, FCG2, FCGR2A1, IGFR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12318 (0-170)
      • see remark 999 (130)
    Domains in SCOPe 2.07: d3d5of1, d3d5of2
  • Heterogens: SO4, NAG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d5oA (A:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d5oB (B:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d5oC (C:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d5oD (D:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d5oE (E:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3d5oF (F:)
    appkavlkleppwinvlqedsvtltcqgarspesdsiqwfhngnlipthtqpsyrfkann
    ndsgeytcqtgqtslsdpvhltvlsewlvlqtphlefqegetimlrchswkdkplvkvtf
    fqngksqkfsrldptfsipqanhshsgdyhctgnigytlfsskpvtitvqvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d5oF (F:)
    appkavlkleppwinvlqedsvtltcqgarspesdsiqwfhngnlipthtqpsyrfkann
    ndsgeytcqtgqtslsdpvhltvlsewlvlqtphlefqegetimlrchswkdkplvkvtf
    fqngksqkfsrldptfsipqanhshsgdyhctgnigytlfsskpvtitvqv