Lineage for d3d5of2 (3d5o F:86-171)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753968Protein automated matches [190803] (3 species)
    not a true protein
  7. 2753969Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries)
  8. 2754016Domain d3d5of2: 3d5o F:86-171 [199225]
    Other proteins in same PDB: d3d5oa_, d3d5ob_, d3d5oc_, d3d5od_, d3d5oe_
    automated match to d2fcba2
    complexed with gol, nag, so4

Details for d3d5of2

PDB Entry: 3d5o (more details), 2.8 Å

PDB Description: structural recognition and functional activation of fcrr by innate pentraxins
PDB Compounds: (F:) Low affinity immunoglobulin gamma Fc region receptor II-a

SCOPe Domain Sequences for d3d5of2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5of2 b.1.1.4 (F:86-171) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewlvlqtphlefqegetimlrchswkdkplvkvtffqngksqkfsrldptfsipqanhsh
sgdyhctgnigytlfsskpvtitvqv

SCOPe Domain Coordinates for d3d5of2:

Click to download the PDB-style file with coordinates for d3d5of2.
(The format of our PDB-style files is described here.)

Timeline for d3d5of2: