SCOPe 2.04: Domain d3cu8a_: 3cu8 A:

Lineage for d3cu8a_ (3cu8 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)
   automatically mapped to Pfam PF00244
5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)

6. Protein zeta isoform [48449] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48451] (7 PDB entries)

8. Domain d3cu8a_: 3cu8 A: [173464]
   automated match to d1qjba_
   complexed with mg, ppi

Details for d3cu8a_

PDB Entry: 3cu8, 2.4 Å

PDB Description: impaired binding of 14-3-3 to raf1 is linked to noonan and leopard syndrome

PDB Compounds: (A:) 14-3-3 protein zeta/delta

SCOPe Domain Sequences for d3cu8a_:

Sequence; same for both SEQRES and ATOM records:

>d3cu8a_ a.118.7.1 (A:) zeta isoform {Human (Homo sapiens) [TaxId: 9606]}
dknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswrv
vssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkm
kgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyei
lnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts

Timeline for d3cu8a_:

• d3cu8a_ first appeared in SCOPe 2.01
  
• d3cu8a_ appears in SCOPe 2.03
  
• d3cu8a_ appears in SCOPe 2.05
  
• d3cu8a_ appears in the current release, SCOPe 2.08