Lineage for d3cu8a_ (3cu8 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726458Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2726459Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2726478Protein zeta isoform [48449] (2 species)
  7. 2726488Species Human (Homo sapiens) [TaxId:9606] [48451] (13 PDB entries)
  8. 2726507Domain d3cu8a_: 3cu8 A: [173464]
    automated match to d1qjba_
    complexed with mg, ppi

Details for d3cu8a_

PDB Entry: 3cu8 (more details), 2.4 Å

PDB Description: impaired binding of 14-3-3 to raf1 is linked to noonan and leopard syndrome
PDB Compounds: (A:) 14-3-3 protein zeta/delta

SCOPe Domain Sequences for d3cu8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cu8a_ a.118.7.1 (A:) zeta isoform {Human (Homo sapiens) [TaxId: 9606]}
dknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswrv
vssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkm
kgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyei
lnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts

SCOPe Domain Coordinates for d3cu8a_:

Click to download the PDB-style file with coordinates for d3cu8a_.
(The format of our PDB-style files is described here.)

Timeline for d3cu8a_: