SCOPe 2.02: Domain d3cspa_: 3csp A:

Lineage for d3cspa_ (3csp A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Myelin oligodendrocyte glycoprotein (MOG) [89174] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [89175] (4 PDB entries)

8. Domain d3cspa_: 3csp A: [173438]
   automated match to d1pkoa_
   mutant

Details for d3cspa_

PDB Entry: 3csp, 1.7 Å

PDB Description: crystal structure of the dm2 mutant of myelin oligodendrocyte glycoprotein

PDB Compounds: (A:) Myelin-oligodendrocyte glycoprotein

SCOPe Domain Sequences for d3cspa_:

Sequence; same for both SEQRES and ATOM records:

>d3cspa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gqfrvigpghpiralvgdeaelpcrispgknatgmevgwyrspfsrvvhlyrngkdqdae
qapeyrgrtellkesigegkvalriqnvrfsdeggytcffrdaeyqeeaavelkvedpfy
w

Timeline for d3cspa_:

• d3cspa_ first appeared in SCOPe 2.01
  
• d3cspa_ appears in SCOPe 2.03
  
• d3cspa_ appears in the current release, SCOPe 2.08, called d3cspa1