SCOPe 2.08: Domain d3cspa1: 3csp A:2-121

Lineage for d3cspa1 (3csp A:2-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Myelin oligodendrocyte glycoprotein (MOG) [89174] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [89175] (4 PDB entries)

8. Domain d3cspa1: 3csp A:2-121 [173438]
   Other proteins in same PDB: d3cspa2
   automated match to d1pkoa_
   mutant

Details for d3cspa1

PDB Entry: 3csp, 1.7 Å

PDB Description: crystal structure of the dm2 mutant of myelin oligodendrocyte glycoprotein

PDB Compounds: (A:) Myelin-oligodendrocyte glycoprotein

SCOPe Domain Sequences for d3cspa1:

Sequence; same for both SEQRES and ATOM records:

>d3cspa1 b.1.1.1 (A:2-121) Myelin oligodendrocyte glycoprotein (MOG) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qfrvigpghpiralvgdeaelpcrispgknatgmevgwyrspfsrvvhlyrngkdqdaeq
apeyrgrtellkesigegkvalriqnvrfsdeggytcffrdaeyqeeaavelkvedpfyw

Timeline for d3cspa1:

• d3cspa1 first appeared in SCOPe 2.01, called d3cspa_
  
• d3cspa1 appears in SCOPe 2.07