Lineage for d1pkoa_ (1pko A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105389Protein Myelin oligodendrocyte glycoprotein (MOG) [89174] (1 species)
  7. 1105390Species Norway rat (Rattus norvegicus) [TaxId:10116] [89175] (4 PDB entries)
  8. 1105391Domain d1pkoa_: 1pko A: [88147]

Details for d1pkoa_

PDB Entry: 1pko (more details), 1.45 Å

PDB Description: Myelin Oligodendrocyte Glycoprotein (MOG)
PDB Compounds: (A:) Myelin Oligodendrocyte Glycoprotein

SCOPe Domain Sequences for d1pkoa_:

Sequence, based on SEQRES records: (download)

>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gqfrvigpghpiralvgdeaelpcrispgknatgmevgwyrspfsrvvhlyrngkdqdae
qapeyrgrtellkesigegkvalriqnvrfsdeggytcffrdhsyqeeaavelkvedpfy
winpgr

Sequence, based on observed residues (ATOM records): (download)

>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gqfrvigpghpiralvgdeaelpcrispgknatgmevgwyrssrvvhlyrngkdqdaeqa
peyrgrtellkesigegkvalriqnvrfsdeggytcffrdhsyqeeaavelkvedpfywi
npgr

SCOPe Domain Coordinates for d1pkoa_:

Click to download the PDB-style file with coordinates for d1pkoa_.
(The format of our PDB-style files is described here.)

Timeline for d1pkoa_: