SCOPe 2.08: Domain d3coda_: 3cod A:

Lineage for d3coda_ (3cod A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)

6. Protein Bacteriorhodopsin [56871] (3 species)
   a light-driven proton pump

7. Species Halobacterium salinarum [TaxId:2242] [56873] (118 PDB entries)
   Uniprot P02945 17-245

8. Domain d3coda_: 3cod A: [173372]
   automated match to d1cwqa_
   complexed with ret; mutant

Details for d3coda_

PDB Entry: 3cod, 2.7 Å

PDB Description: crystal structure of t90a/d115a mutant of bacteriorhodopsin

PDB Compounds: (A:) bacteriorhodopsin

SCOPe Domain Sequences for d3coda_:

Sequence; same for both SEQRES and ATOM records:

>d3coda_ f.13.1.1 (A:) Bacteriorhodopsin {Halobacterium salinarum [TaxId: 2242]}
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlftaplllldlallvdadqgtilalvgaagimigtglv
galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg

Timeline for d3coda_:

• d3coda_ first appeared in SCOPe 2.01
  
• d3coda_ appears in SCOPe 2.07