| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
| Protein Calcium- and integrin-binding protein, CIB [47541] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47542] (3 PDB entries) Uniprot Q99828 |
| Domain d1dgua_: 1dgu A: [17333] has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1dgu (more details)
SCOPe Domain Sequences for d1dgua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dgua_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}
skellaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanp
fkericrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredl
srlvncltgegedtrlsasemkqlidnileesdidrdgtinlsefqhvisrspdfassfk
ivl
Timeline for d1dgua_: