Lineage for d3cldb_ (3cld B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008769Protein Glucocorticoid receptor [89140] (1 species)
  7. 2008770Species Human (Homo sapiens) [TaxId:9606] [89141] (6 PDB entries)
  8. 2008775Domain d3cldb_: 3cld B: [173314]
    automated match to d1m2za_
    protein/DNA complex; complexed with gw6

Details for d3cldb_

PDB Entry: 3cld (more details), 2.84 Å

PDB Description: Ligand binding domain of the glucocorticoid receptor complexed with fluticazone furoate
PDB Compounds: (B:) Glucocorticoid receptor

SCOPe Domain Sequences for d3cldb_:

Sequence, based on SEQRES records: (download)

>d3cldb_ a.123.1.1 (B:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]}
ltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfrnl
hlddqmtllqyswmylmafalgwrsyrqssanllcfapdliineqrmtlpgmydqckhml
yvsselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelgkaivkregn
ssqnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkysng
nikkllfhq

Sequence, based on observed residues (ATOM records): (download)

>d3cldb_ a.123.1.1 (B:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]}
ltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfrnl
hlddqmtllqyswmylmafalgwrsyrqnllcfapdliineqrmtlpgmydqckhmlyvs
selhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelgkaivkrqnwqrf
yqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkysngnikkllfh
q

SCOPe Domain Coordinates for d3cldb_:

Click to download the PDB-style file with coordinates for d3cldb_.
(The format of our PDB-style files is described here.)

Timeline for d3cldb_: