Lineage for d1m2za_ (1m2z A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
multihelical; 3 layers or orthogonally packed helicesSuperfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) 
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) 
Protein Glucocorticoid receptor [89140] (1 species) Species Human (Homo sapiens) [TaxId:9606] [89141] (8 PDB entries) 
Domain d1m2za_: 1m2z A: [84768]
complexed with coactivator peptide, chains B and E
complexed with bog, dex
Details for d1m2za_
PDB Entry: 1m2z (more details), 2.5 Å
PDB Description: crystal structure of a dimer complex of the human glucocorticoid receptor ligand-binding domain bound to dexamethasone and a tif2 coactivator motif
PDB Compounds: (A:) Glucocorticoid receptorSCOPe Domain Sequences for d1m2za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m2za_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]}
atlpqltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaip
gfrnlhlddqmtllqyswmslmafalgwrsyrqssanllcfapdliineqrmtlpcmydq
ckhmlyvsselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelgkaiv
kregnssqnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqip
kysngnikkllfhqk
SCOPe Domain Coordinates for d1m2za_:
Click to download the PDB-style file with coordinates for d1m2za_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1m2za_:
- d1m2za_ first appeared in SCOP 1.65
- d1m2za_ appears in SCOPe 2.07
View in 3D
