Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries) Uniprot P01887 |
Domain d3ch1b_: 3ch1 B: [173237] Other proteins in same PDB: d3ch1a1, d3ch1a2, d3ch1d1, d3ch1d2, d3ch1g1, d3ch1g2, d3ch1j1, d3ch1j2 automated match to d1biib_ complexed with gol, so4 |
PDB Entry: 3ch1 (more details), 2.3 Å
SCOPe Domain Sequences for d3ch1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ch1b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d3ch1b_: