SCOPe 2.07: Domain d3ch1d2: 3ch1 D:182-276

Lineage for d3ch1d2 (3ch1 D:182-276)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries)
   Uniprot P01901 22-299

8. Domain d3ch1d2: 3ch1 D:182-276 [199183]
   Other proteins in same PDB: d3ch1a1, d3ch1b_, d3ch1d1, d3ch1e_, d3ch1g1, d3ch1h_, d3ch1j1, d3ch1k_
   automated match to d1qlfa1
   complexed with gol, so4

Details for d3ch1d2

PDB Entry: 3ch1, 2.3 Å

PDB Description: Crystal structure of H-2Db in complex with chimeric gp100

PDB Compounds: (D:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d3ch1d2:

Sequence; same for both SEQRES and ATOM records:

>d3ch1d2 b.1.1.2 (D:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

Timeline for d3ch1d2:

• d3ch1d2 first appeared in SCOPe 2.03
  
• d3ch1d2 appears in SCOPe 2.06
  
• d3ch1d2 appears in the current release, SCOPe 2.08