Lineage for d3ch1j1 (3ch1 J:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2545067Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (28 PDB entries)
  8. 2545090Domain d3ch1j1: 3ch1 J:1-181 [199186]
    Other proteins in same PDB: d3ch1a2, d3ch1b_, d3ch1d2, d3ch1e_, d3ch1g2, d3ch1h_, d3ch1j2, d3ch1k_
    automated match to d1qlfa2
    complexed with gol, so4

Details for d3ch1j1

PDB Entry: 3ch1 (more details), 2.3 Å

PDB Description: Crystal structure of H-2Db in complex with chimeric gp100
PDB Compounds: (J:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d3ch1j1:

Sequence, based on SEQRES records: (download)

>d3ch1j1 d.19.1.1 (J:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

Sequence, based on observed residues (ATOM records): (download)

>d3ch1j1 d.19.1.1 (J:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgeepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnlr

SCOPe Domain Coordinates for d3ch1j1:

Click to download the PDB-style file with coordinates for d3ch1j1.
(The format of our PDB-style files is described here.)

Timeline for d3ch1j1: