Lineage for d1dfkz_ (1dfk Z:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355182Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 355183Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 355357Family a.39.1.5: Calmodulin-like [47502] (21 proteins)
    Duplication: made with two pairs of EF-hands
  6. 355536Protein Myosin Regulatory Chain [47527] (2 species)
  7. 355537Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47528] (11 PDB entries)
  8. 355546Domain d1dfkz_: 1dfk Z: [17320]
    Other proteins in same PDB: d1dfka1, d1dfka2, d1dfky_
    complexed with ca

Details for d1dfkz_

PDB Entry: 1dfk (more details), 4.2 Å

PDB Description: nucleotide-free scallop myosin s1-near rigor state

SCOP Domain Sequences for d1dfkz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfkz_ a.39.1.5 (Z:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians)}
lsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgeks
lpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsdedv
deiikltdlqedlegnvkyedfvkkvmagpyp

SCOP Domain Coordinates for d1dfkz_:

Click to download the PDB-style file with coordinates for d1dfkz_.
(The format of our PDB-style files is described here.)

Timeline for d1dfkz_: