Lineage for d3bwya_ (3bwy A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 999457Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 999458Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 999459Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 999478Protein automated matches [190251] (3 species)
    not a true protein
  7. 999479Species Human (Homo sapiens) [TaxId:9606] [188458] (4 PDB entries)
  8. 999480Domain d3bwya_: 3bwy A: [172889]
    automated match to d1h1da_
    complexed with dnc, mg, mpd, sam

Details for d3bwya_

PDB Entry: 3bwy (more details), 1.3 Å

PDB Description: crystal structure of human 108m catechol o-methyltransferase bound with s-adenosylmethionine and inhibitor dinitrocatechol
PDB Compounds: (A:) COMT protein

SCOPe Domain Sequences for d3bwya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bwya_ c.66.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdtkeqrilnhvlqhaepgnaqsvleaidtyceqkewamnvgdkkgkivdaviqehqpsv
llelgaycgysavrmarllspgarlitieinpdcaaitqrmvdfagmkdkvtlvvgasqd
iipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvicpgapdfla
hvrgsscfecthyqsfleyrevvdglekaiykgp

SCOPe Domain Coordinates for d3bwya_:

Click to download the PDB-style file with coordinates for d3bwya_.
(The format of our PDB-style files is described here.)

Timeline for d3bwya_: