SCOPe 2.04: Domain d3buvb_: 3buv B:

Lineage for d3buvb_ (3buv B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein automated matches [190169] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188399] (48 PDB entries)

8. Domain d3buvb_: 3buv B: [172832]
   automated match to d1q13a_
   complexed with epe, gol, nap

Details for d3buvb_

PDB Entry: 3buv, 1.35 Å

PDB Description: Crystal structure of human Delta(4)-3-ketosteroid 5-beta-reductase in complex with NADP and HEPES. Resolution: 1.35 A.

PDB Compounds: (B:) 3-oxo-5-beta-steroid 4-dehydrogenase

SCOPe Domain Sequences for d3buvb_:

Sequence; same for both SEQRES and ATOM records:

>d3buvb_ c.1.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlsaashriplsdgnsipiiglgtysepkstpkgacatsvkvaidtgyrhidgayiyqne
hevgeairekiaegkvrredifycgklwatnhvpemvrptlertlrvlqldyvdlyiiev
pmafkpgdeiyprdengkwlyhksnlcatweameackdaglvkslgvsnfnrrqleliln
kpglkhkpvsnqvechpyftqpkllkfcqqhdivitaysplgtsrnpiwvnvssppllkd
allnslgkrynktaaqivlrfniqrgvvvipksfnlerikenfqifdfslteeemkdiea
lnknvrfvellmwrdhpeypfhdey

Timeline for d3buvb_:

• d3buvb_ first appeared in SCOPe 2.01
  
• d3buvb_ appears in SCOPe 2.03
  
• d3buvb_ appears in SCOPe 2.05
  
• d3buvb_ appears in the current release, SCOPe 2.08