Lineage for d3buva_ (3buv A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568069Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1568070Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1568369Protein automated matches [190169] (5 species)
    not a true protein
  7. 1568370Species Human (Homo sapiens) [TaxId:9606] [188399] (48 PDB entries)
  8. 1568382Domain d3buva_: 3buv A: [172831]
    automated match to d1q13a_
    complexed with epe, gol, nap

Details for d3buva_

PDB Entry: 3buv (more details), 1.35 Å

PDB Description: Crystal structure of human Delta(4)-3-ketosteroid 5-beta-reductase in complex with NADP and HEPES. Resolution: 1.35 A.
PDB Compounds: (A:) 3-oxo-5-beta-steroid 4-dehydrogenase

SCOPe Domain Sequences for d3buva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3buva_ c.1.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlsaashriplsdgnsipiiglgtysepkstpkgacatsvkvaidtgyrhidgayiyqne
hevgeairekiaegkvrredifycgklwatnhvpemvrptlertlrvlqldyvdlyiiev
pmafkpgdeiyprdengkwlyhksnlcatweameackdaglvkslgvsnfnrrqleliln
kpglkhkpvsnqvechpyftqpkllkfcqqhdivitaysplgtsrnpiwvnvssppllkd
allnslgkrynktaaqivlrfniqrgvvvipksfnlerikenfqifdfslteeemkdiea
lnknvrfvellmwrdhpeypfhdey

SCOPe Domain Coordinates for d3buva_:

Click to download the PDB-style file with coordinates for d3buva_.
(The format of our PDB-style files is described here.)

Timeline for d3buva_: