Lineage for d1cmfa_ (1cmf A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2710608Protein Calmodulin [47516] (13 species)
  7. 2710665Species Cow (Bos taurus) [TaxId:9913] [47518] (16 PDB entries)
    Uniprot P62157
  8. 2710681Domain d1cmfa_: 1cmf A: [17283]
    C-terminal domain in apo form
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1cmfa_

PDB Entry: 1cmf (more details)

PDB Description: nmr solution structure of apo calmodulin carboxy-terminal domain
PDB Compounds: (A:) calmodulin (vertebrate)

SCOPe Domain Sequences for d1cmfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cmfa_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}
mkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgq
vnyeefvqmmtak

SCOPe Domain Coordinates for d1cmfa_:

Click to download the PDB-style file with coordinates for d1cmfa_.
(The format of our PDB-style files is described here.)

Timeline for d1cmfa_: