Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (13 species) |
Species Cow (Bos taurus) [TaxId:9913] [47518] (16 PDB entries) Uniprot P62157 |
Domain d1cmfa_: 1cmf A: [17283] C-terminal domain in apo form fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1cmf (more details)
SCOPe Domain Sequences for d1cmfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cmfa_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} mkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgq vnyeefvqmmtak
Timeline for d1cmfa_: