SCOPe 2.08: Domain d3bewb_: 3bew B:

Lineage for d3bewb_ (3bew B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries)

8. Domain d3bewb_: 3bew B: [172578]
   automated match to d1hlam_

Details for d3bewb_

PDB Entry: 3bew, 2.6 Å

PDB Description: 10mer Crystal Structure of chicken MHC class I haplotype B21

PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d3bewb_:

Sequence; same for both SEQRES and ATOM records:

>d3bewb_ b.1.1.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mdltpkvqvysrfpasagtknvlncfaagfhppkisitlmkdgvpmegaqysdmsfnddw
tfqrlvhadftpssgstyackvehetlkepqvykwdpef

Timeline for d3bewb_:

• d3bewb_ first appeared in SCOPe 2.01
  
• d3bewb_ appears in SCOPe 2.07