Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries) |
Domain d3bewb_: 3bew B: [172578] automated match to d1hlam_ |
PDB Entry: 3bew (more details), 2.6 Å
SCOPe Domain Sequences for d3bewb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bewb_ b.1.1.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} mdltpkvqvysrfpasagtknvlncfaagfhppkisitlmkdgvpmegaqysdmsfnddw tfqrlvhadftpssgstyackvehetlkepqvykwdpef
Timeline for d3bewb_: