Lineage for d3bewb_ (3bew B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 935707Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 935708Protein automated matches [190740] (5 species)
    not a true protein
  7. 935709Species Chicken (Gallus gallus) [TaxId:9031] [188287] (6 PDB entries)
  8. 935715Domain d3bewb_: 3bew B: [172578]
    automated match to d1hlam_

Details for d3bewb_

PDB Entry: 3bew (more details), 2.6 Å

PDB Description: 10mer Crystal Structure of chicken MHC class I haplotype B21
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d3bewb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bewb_ b.1.1.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mdltpkvqvysrfpasagtknvlncfaagfhppkisitlmkdgvpmegaqysdmsfnddw
tfqrlvhadftpssgstyackvehetlkepqvykwdpef

SCOPe Domain Coordinates for d3bewb_:

Click to download the PDB-style file with coordinates for d3bewb_.
(The format of our PDB-style files is described here.)

Timeline for d3bewb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3bewe_