PDB entry 3bew

View 3bew on RCSB PDB site
Description: 10mer Crystal Structure of chicken MHC class I haplotype B21
Class: immune system
Keywords: MHC class I, chicken, 10mer, bulge, peptide, water cushion, Immune response, Immunoglobulin domain, MHC I, Polymorphism, Secreted, GTP-binding, Microtubule, Nucleotide-binding, IMMUNE SYSTEM
Deposited on 2007-11-20, released 2008-01-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.237
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major histocompatibility complex class I glycoprotein haplotype B21
    Species: Gallus gallus [TaxId:9031]
    Gene: BFIV21, B-FIV, BF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95601 (0-269)
      • expression tag (270)
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Gallus gallus [TaxId:9031]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21611 (1-98)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d3bewb_
  • Chain 'C':
    Compound: 10-mer from Tubulin beta-6 chain
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Major histocompatibility complex class I glycoprotein haplotype B21
    Species: Gallus gallus [TaxId:9031]
    Gene: BFIV21, B-FIV, BF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95601 (0-269)
      • expression tag (270)
  • Chain 'E':
    Compound: Beta-2-microglobulin
    Species: Gallus gallus [TaxId:9031]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21611 (1-98)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d3bewe_
  • Chain 'F':
    Compound: 10-mer from Tubulin beta-6 chain
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bewB (B:)
    mdltpkvqvysrfpasagtknvlncfaagfhppkisitlmkdgvpmegaqysdmsfnddw
    tfqrlvhadftpssgstyackvehetlkepqvykwdpef
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bewE (E:)
    mdltpkvqvysrfpasagtknvlncfaagfhppkisitlmkdgvpmegaqysdmsfnddw
    tfqrlvhadftpssgstyackvehetlkepqvykwdpef
    

  • Chain 'F':
    No sequence available.