PDB entry 3bew
View 3bew on RCSB PDB site
Description: 10mer Crystal Structure of chicken MHC class I haplotype B21
Class: immune system
Keywords: MHC class I, chicken, 10mer, bulge, peptide, water cushion, Immune response, Immunoglobulin domain, MHC I, Polymorphism, Secreted, GTP-binding, Microtubule, Nucleotide-binding, IMMUNE SYSTEM
Deposited on
2007-11-20, released
2008-01-01
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.237
AEROSPACI score: 0.27
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Major histocompatibility complex class I glycoprotein haplotype B21
Species: Gallus gallus [TaxId:9031]
Gene: BFIV21, B-FIV, BF2
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Beta-2-microglobulin
Species: Gallus gallus [TaxId:9031]
Gene: B2M
Database cross-references and differences (RAF-indexed):
- Uniprot P21611 (1-98)
- initiating methionine (0)
Domains in SCOPe 2.08: d3bewb_ - Chain 'C':
Compound: 10-mer from Tubulin beta-6 chain
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Major histocompatibility complex class I glycoprotein haplotype B21
Species: Gallus gallus [TaxId:9031]
Gene: BFIV21, B-FIV, BF2
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: Beta-2-microglobulin
Species: Gallus gallus [TaxId:9031]
Gene: B2M
Database cross-references and differences (RAF-indexed):
- Uniprot P21611 (1-98)
- initiating methionine (0)
Domains in SCOPe 2.08: d3bewe_ - Chain 'F':
Compound: 10-mer from Tubulin beta-6 chain
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3bewB (B:)
mdltpkvqvysrfpasagtknvlncfaagfhppkisitlmkdgvpmegaqysdmsfnddw
tfqrlvhadftpssgstyackvehetlkepqvykwdpef
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>3bewE (E:)
mdltpkvqvysrfpasagtknvlncfaagfhppkisitlmkdgvpmegaqysdmsfnddw
tfqrlvhadftpssgstyackvehetlkepqvykwdpef
- Chain 'F':
No sequence available.