Lineage for d3bewe_ (3bew E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754067Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries)
  8. 2754105Domain d3bewe_: 3bew E: [172579]
    automated match to d1hlam_

Details for d3bewe_

PDB Entry: 3bew (more details), 2.6 Å

PDB Description: 10mer Crystal Structure of chicken MHC class I haplotype B21
PDB Compounds: (E:) Beta-2-microglobulin

SCOPe Domain Sequences for d3bewe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bewe_ b.1.1.0 (E:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mdltpkvqvysrfpasagtknvlncfaagfhppkisitlmkdgvpmegaqysdmsfnddw
tfqrlvhadftpssgstyackvehetlkepqvykwdpef

SCOPe Domain Coordinates for d3bewe_:

Click to download the PDB-style file with coordinates for d3bewe_.
(The format of our PDB-style files is described here.)

Timeline for d3bewe_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3bewb_