Lineage for d1rtp1_ (1rtp 1:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355182Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 355183Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 355316Family a.39.1.4: Parvalbumin [47492] (2 proteins)
    6-helices; array of 3 hairpins, closed
    made with two-helical hairpin and two EF-hands
  6. 355321Protein Parvalbumin [47495] (6 species)
  7. 355344Species Rat (Rattus rattus) [TaxId:10117] [47501] (3 PDB entries)
  8. 355349Domain d1rtp1_: 1rtp 1: [17219]

Details for d1rtp1_

PDB Entry: 1rtp (more details), 2 Å

PDB Description: refined x-ray structure of rat parvalbumin, a mammalian alpha-lineage parvalbumin, at 2.0 a resolution

SCOP Domain Sequences for d1rtp1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rtp1_ a.39.1.4 (1:) Parvalbumin {Rat (Rattus rattus)}
smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
delgsilkgfssdardlsaketktlmaagdkdgdgkigveefstlvaes

SCOP Domain Coordinates for d1rtp1_:

Click to download the PDB-style file with coordinates for d1rtp1_.
(The format of our PDB-style files is described here.)

Timeline for d1rtp1_: