SCOPe 2.08: Domain d1rtp1_: 1rtp 1:

Lineage for d1rtp1_ (1rtp 1:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.4: Parvalbumin [47492] (3 proteins)
   6-helices; array of 3 hairpins, closed
   made with two-helical hairpin and two EF-hands

6. Protein Parvalbumin [47495] (9 species)

7. Species Rat (Rattus rattus) [TaxId:10117] [47501] (1 PDB entry)
   Uniprot P02625

8. Domain d1rtp1_: 1rtp 1: [17219]
   complexed with ca

Details for d1rtp1_

PDB Entry: 1rtp, 2 Å

PDB Description: refined x-ray structure of rat parvalbumin, a mammalian alpha-lineage parvalbumin, at 2.0 a resolution

PDB Compounds: (1:) alpha-parvalbumin

SCOPe Domain Sequences for d1rtp1_:

Sequence; same for both SEQRES and ATOM records:

>d1rtp1_ a.39.1.4 (1:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}
smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
delgsilkgfssdardlsaketktlmaagdkdgdgkigveefstlvaes

Timeline for d1rtp1_:

• d1rtp1_ first appeared (with stable ids) in SCOP 1.55
  
• d1rtp1_ appears in SCOPe 2.07