SCOPe 2.08: Domain d3abld_: 3abl D:

Lineage for d3abld_ (3abl D:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family)
   automatically mapped to Pfam PF02936

5. Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins)

6. Protein automated matches [190270] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187062] (26 PDB entries)

8. Domain d3abld_: 3abl D: [171948]
   Other proteins in same PDB: d3abla_, d3ablb1, d3ablb2, d3ablc_, d3able_, d3ablf_, d3ablg_, d3ablh_, d3abli_, d3ablj_, d3ablk_, d3abll_, d3ablm_, d3abln_, d3ablo1, d3ablo2, d3ablp_, d3ablr_, d3abls_, d3ablt_, d3ablu_, d3ablv_, d3ablw_, d3ablx_, d3ably_, d3ablz_
   automated match to d1occd_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d3abld_

PDB Entry: 3abl, 2.1 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (15-s X-ray exposure dataset)

PDB Compounds: (D:) Cytochrome c oxidase subunit 4 isoform 1

SCOPe Domain Sequences for d3abld_:

Sequence; same for both SEQRES and ATOM records:

>d3abld_ f.23.1.1 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

Timeline for d3abld_:

• d3abld_ first appeared in SCOPe 2.01
  
• d3abld_ appears in SCOPe 2.07