| Class g: Small proteins [56992] (100 folds) |
| Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
| Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins) membrane-anchored rubredoxin-like domain automatically mapped to Pfam PF01215 |
| Protein Cytochrome c oxidase Subunit F [57819] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [57820] (50 PDB entries) |
| Domain d3abls_: 3abl S: [171962] Other proteins in same PDB: d3abla_, d3ablb1, d3ablb2, d3ablc_, d3abld_, d3able_, d3ablg_, d3ablh_, d3abli_, d3ablj_, d3ablk_, d3abll_, d3ablm_, d3abln_, d3ablo1, d3ablo2, d3ablp_, d3ablq_, d3ablr_, d3ablt_, d3ablu_, d3ablv_, d3ablw_, d3ablx_, d3ably_, d3ablz_ automated match to d1occf_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn |
PDB Entry: 3abl (more details), 2.1 Å
SCOPe Domain Sequences for d3abls_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3abls_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
ggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgcice
ednstviwfwlhkgeaqrcpscgthyklvphql
Timeline for d3abls_:
View in 3DDomains from other chains: (mouse over for more information) d3abla_, d3ablb1, d3ablb2, d3ablc_, d3abld_, d3able_, d3ablf_, d3ablg_, d3ablh_, d3abli_, d3ablj_, d3ablk_, d3abll_, d3ablm_, d3abln_, d3ablo1, d3ablo2, d3ablp_, d3ablq_, d3ablr_, d3ablt_, d3ablu_, d3ablv_, d3ablw_, d3ablx_, d3ably_, d3ablz_ |